(data stored in ACNUC7421 zone)

EMBL: CP000270.PE193

CP000270.PE193       Location/Qualifiers
FT   CDS             complement(226801..227043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28731"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K8"
FT                   /protein_id="ABE28731.1"
FT                   /translation="MIVAPGAVWANQVFVLWLWDKYAGKCTDERADKKRDPMHGRIRTR
FT                   MRPQSSARYGPADGKPSPEPHARAQTRAMRVEKVE"
     MIVAPGAVWA NQVFVLWLWD KYAGKCTDER ADKKRDPMHG RIRTRMRPQS SARYGPADGK        60
     PSPEPHARAQ TRAMRVEKVE                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page