(data stored in ACNUC7421 zone)

EMBL: CP000270.PE194

CP000270.PE194       Location/Qualifiers
FT   CDS             227073..227675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4268"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28732"
FT                   /db_xref="GOA:Q146K7"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K7"
FT                   /protein_id="ABE28732.1"
FT                   /translation="MLSCTRSTWPPRLVTVPGLHGSEGAHWQTWLERQFARSLRVEQAD
FT                   WDAPDLALWSRSLRDLLARERGPFVLAAHSFGCLAAAHALQQAPYANDVVGVLFVAPAS
FT                   PQKFAFAGAFDARRLGVPSILIGSQTDPWMSLAGARDLAQRFGSAFVNLGDAGHINTAA
FT                   GFGPWPRAKYFVDTLVHCAAPLRFREESIEAAQHAFI"
     MLSCTRSTWP PRLVTVPGLH GSEGAHWQTW LERQFARSLR VEQADWDAPD LALWSRSLRD        60
     LLARERGPFV LAAHSFGCLA AAHALQQAPY ANDVVGVLFV APASPQKFAF AGAFDARRLG       120
     VPSILIGSQT DPWMSLAGAR DLAQRFGSAF VNLGDAGHIN TAAGFGPWPR AKYFVDTLVH       180
     CAAPLRFREE SIEAAQHAFI                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page