(data stored in ACNUC7421 zone)

EMBL: CP000270.PE195

CP000270.PE195       Location/Qualifiers
FT   CDS             227809..228834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4267"
FT                   /product="Putative ABC sulfate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28733"
FT                   /db_xref="GOA:Q146K6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K6"
FT                   /protein_id="ABE28733.1"
FT                   /translation="MAGKTGTSRWLAAGMTAMTLALAGVPAAHAETSLLNVSYDVTREL
FT                   YKDINAGFIAAYKQKSGETVSIRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAEK
FT                   GQLLPANWRTRLPNDSVPYTTTMVFLVRKGNPKHIKDWDDLARPGVQVIIANPKTSGNG
FT                   RYTYLAAWGYRKQHGGTDAQALDFEKAIFKNVPVLDTGGRGATTTFTQRGIGDVLVTFE
FT                   NEVALMDTGVGGGNFEAVYPSVSLLAAPPVSIVDKVVDKRGTRKEAQAYLDYLWSPAAQ
FT                   EIIAQHHLRPQDKTVLAKHASEFKAIKTFTVEEMFGGWQKAQQTHFSDGGTFDQIIVDK
FT                   K"
     MAGKTGTSRW LAAGMTAMTL ALAGVPAAHA ETSLLNVSYD VTRELYKDIN AGFIAAYKQK        60
     SGETVSIRQS HGASSAQALS VLQGLQADVV TMNQPNDIDL LAEKGQLLPA NWRTRLPNDS       120
     VPYTTTMVFL VRKGNPKHIK DWDDLARPGV QVIIANPKTS GNGRYTYLAA WGYRKQHGGT       180
     DAQALDFEKA IFKNVPVLDT GGRGATTTFT QRGIGDVLVT FENEVALMDT GVGGGNFEAV       240
     YPSVSLLAAP PVSIVDKVVD KRGTRKEAQA YLDYLWSPAA QEIIAQHHLR PQDKTVLAKH       300
     ASEFKAIKTF TVEEMFGGWQ KAQQTHFSDG GTFDQIIVDK K                           341
//

If you have problems or comments...

PBIL Back to PBIL home page