(data stored in ACNUC7421 zone)

EMBL: CP000270.PE200

CP000270.PE200       Location/Qualifiers
FT   CDS             233584..234330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28738"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K1"
FT                   /protein_id="ABE28738.1"
FT                   /translation="MGFTGGNWGGGWFFVCAGLCVCVPGGLAFPCIHGGLLALPLCGAA
FT                   PTFFAAAKKVGKESRFTPPTLKRVPWLGGDSGASGICVVAHSALVTRPSYFPPRTACSP
FT                   ERSGKTSVVRVWGVGFGSAWRRKVSRACVQTAHRTTAVMEAPSANSRGRQRLRRLSRKE
FT                   QAATLKARFAPVATGEQRDIARARGNQRFEKRRAQEVSGKISPVREATTGFNELPRRRA
FT                   QRRRKNDGLVTKAECATTQIPDGPLP"
     MGFTGGNWGG GWFFVCAGLC VCVPGGLAFP CIHGGLLALP LCGAAPTFFA AAKKVGKESR        60
     FTPPTLKRVP WLGGDSGASG ICVVAHSALV TRPSYFPPRT ACSPERSGKT SVVRVWGVGF       120
     GSAWRRKVSR ACVQTAHRTT AVMEAPSANS RGRQRLRRLS RKEQAATLKA RFAPVATGEQ       180
     RDIARARGNQ RFEKRRAQEV SGKISPVREA TTGFNELPRR RAQRRRKNDG LVTKAECATT       240
     QIPDGPLP                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page