(data stored in ACNUC7421 zone)

EMBL: CP000270.PE204

CP000270.PE204       Location/Qualifiers
FT   CDS             complement(237694..238143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4258"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28742"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J7"
FT                   /protein_id="ABE28742.1"
FT                   /translation="MNKQLLPLQRPSDCPCGGAAPDQRSGARAPRFAQCCGRYIDGGEA
FT                   APRAHELMRSRYSAYVVGATDYLRATWAAHTCPADLDADPAAPDAPRWLGLQIKAFAET
FT                   DAHHATVEFVARYKVGGRAHRLHELSRFVRGEDGRWRYVDGDVSE"
     MNKQLLPLQR PSDCPCGGAA PDQRSGARAP RFAQCCGRYI DGGEAAPRAH ELMRSRYSAY        60
     VVGATDYLRA TWAAHTCPAD LDADPAAPDA PRWLGLQIKA FAETDAHHAT VEFVARYKVG       120
     GRAHRLHELS RFVRGEDGRW RYVDGDVSE                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page