(data stored in ACNUC7421 zone)

EMBL: CP000270.PE21

CP000270.PE21        Location/Qualifiers
FT   CDS             complement(26407..26802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4442"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28559"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D0"
FT                   /protein_id="ABE28559.1"
FT                   /translation="MADEKEVARVIATPAAVELIDKLRAEHGAVLFHQSGGCCDGSAPM
FT                   MFPQSEFMVGSSDVKLGTIADVPFYMSESQFEYWQHTQLIIDVVPGNGGMFSLERPSGL
FT                   RFLTRSRLFEDDENAWLETHPVQRADA"
     MADEKEVARV IATPAAVELI DKLRAEHGAV LFHQSGGCCD GSAPMMFPQS EFMVGSSDVK        60
     LGTIADVPFY MSESQFEYWQ HTQLIIDVVP GNGGMFSLER PSGLRFLTRS RLFEDDENAW       120
     LETHPVQRAD A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page