(data stored in ACNUC7421 zone)

EMBL: CP000270.PE211

CP000270.PE211       Location/Qualifiers
FT   CDS             244756..245829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4251"
FT                   /product="Putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28749"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J0"
FT                   /protein_id="ABE28749.1"
FT                   /translation="MNALEHQLDYPFNDALPDPGHAMEVAPGVFWLRMPLPFALDHINL
FT                   WLLRDEIDGQQGWTVVDCGIASDTIRENWEKVFDSVLDGLPVLRVIVTHCHPDHIGLAH
FT                   WICAGGDKKRWDVRLWTTLGEYMQARVMAAGDGSNAGGEGAARHFARHGVTDEESLEKL
FT                   RNRKSYYSSLVPEIPGQYRRLREADGVKIGGKTWRVVTGFGHSPEHCALFCEETGVLIS
FT                   GDMVLPRISTNVSVFDMEPEGSPLALYLESLGRYETMPEDTLVLPSHGKPFRGVRTRIR
FT                   QLREHHDARLAEVREACAEQPQSAADIVPLMFKRQLDIHQMTFAMGEALAHLHLLWLAG
FT                   ELKRKQDADGVIRFSPA"
     MNALEHQLDY PFNDALPDPG HAMEVAPGVF WLRMPLPFAL DHINLWLLRD EIDGQQGWTV        60
     VDCGIASDTI RENWEKVFDS VLDGLPVLRV IVTHCHPDHI GLAHWICAGG DKKRWDVRLW       120
     TTLGEYMQAR VMAAGDGSNA GGEGAARHFA RHGVTDEESL EKLRNRKSYY SSLVPEIPGQ       180
     YRRLREADGV KIGGKTWRVV TGFGHSPEHC ALFCEETGVL ISGDMVLPRI STNVSVFDME       240
     PEGSPLALYL ESLGRYETMP EDTLVLPSHG KPFRGVRTRI RQLREHHDAR LAEVREACAE       300
     QPQSAADIVP LMFKRQLDIH QMTFAMGEAL AHLHLLWLAG ELKRKQDADG VIRFSPA          357
//

If you have problems or comments...

PBIL Back to PBIL home page