(data stored in ACNUC7421 zone)

EMBL: CP000270.PE216

CP000270.PE216       Location/Qualifiers
FT   CDS             complement(250182..250979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4246"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28754"
FT                   /db_xref="GOA:Q146I5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I5"
FT                   /protein_id="ABE28754.1"
FT                   /translation="MAKPRRTTKQSKQTGGTFLGIVLGLIVGLAIAVVVALYITRAPTP
FT                   FVSKVAPPAASDSGASQPQYDPNRPLQGKTPGQPVPQAAQPAPPNTAPGQTNAQTQSGM
FT                   LEEPQIVEVPPANGNAGNANGTAVAPKPAQDNGTGTAAAPVKKPQAASAPAATAAGAAP
FT                   KGGSSTAANARPGSGAAPAAGDANTGYFLQVGAYKTAADAEQQRARLAFQGFESKVTQR
FT                   DAGGVTYYRVRIGPFSKFEDMNSSRQRLSDAGVDTAVIRFTKQ"
     MAKPRRTTKQ SKQTGGTFLG IVLGLIVGLA IAVVVALYIT RAPTPFVSKV APPAASDSGA        60
     SQPQYDPNRP LQGKTPGQPV PQAAQPAPPN TAPGQTNAQT QSGMLEEPQI VEVPPANGNA       120
     GNANGTAVAP KPAQDNGTGT AAAPVKKPQA ASAPAATAAG AAPKGGSSTA ANARPGSGAA       180
     PAAGDANTGY FLQVGAYKTA ADAEQQRARL AFQGFESKVT QRDAGGVTYY RVRIGPFSKF       240
     EDMNSSRQRL SDAGVDTAVI RFTKQ                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page