(data stored in ACNUC7421 zone)

EMBL: CP000270.PE220

CP000270.PE220       Location/Qualifiers
FT   CDS             complement(256884..257588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4242"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28758"
FT                   /db_xref="InterPro:IPR025455"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I1"
FT                   /protein_id="ABE28758.1"
FT                   /translation="MVELIIVGEGQTEETFVRDVLAPALGANHVYASARLISTSREQRG
FT                   GALSLERVRKFIGHTLRQRADTYVTTLIDLYGLDKSFRGVMASKGQTPATRAAHIERLL
FT                   HEDVVGFAECRPERFIPHVQPHEFESLLFSDVTRLCDVEPEWHEQSDPLIAARAAVDDP
FT                   EWINDSPQTAPSKRLERLQPRYRKVRHGPLAAARIGLDRIREQCPHFRQWYDRIVTLPA
FT                   LQAQQPNIEYTS"
     MVELIIVGEG QTEETFVRDV LAPALGANHV YASARLISTS REQRGGALSL ERVRKFIGHT        60
     LRQRADTYVT TLIDLYGLDK SFRGVMASKG QTPATRAAHI ERLLHEDVVG FAECRPERFI       120
     PHVQPHEFES LLFSDVTRLC DVEPEWHEQS DPLIAARAAV DDPEWINDSP QTAPSKRLER       180
     LQPRYRKVRH GPLAAARIGL DRIREQCPHF RQWYDRIVTL PALQAQQPNI EYTS             234
//

If you have problems or comments...

PBIL Back to PBIL home page