(data stored in ACNUC7421 zone)

EMBL: CP000270.PE221

CP000270.PE221       Location/Qualifiers
FT   CDS             complement(257588..258682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4241"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28759"
FT                   /db_xref="GOA:Q146I0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I0"
FT                   /protein_id="ABE28759.1"
FT                   /translation="MAGVTKLTIAGFKSIRELRDFELRNLNVLIGANGAGKSNFIGFFK
FT                   LLAEMYERRLQLFVQQQGGSDTLLHFSRKLTDKIEGELNFGTDYDHYRFELVVTNDNRL
FT                   IFTNEQYWLHSRGSRPGEVGLLGGNKDESDLKKLAAQQKSPLIDDILNSTRVYHFHDTG
FT                   EKAKVKQPHALNDTLRLKVDGANLAAYLRMLKTEHAESYRQIVDTIRLVAPFFDDFVFR
FT                   ADSASKIQLEWTERGDPDTPFTAHALSDGTLRFICLGTLLLQPWELMPATILIDEPELG
FT                   LHPYAINLLADLLKRASEQKQLIVSTQSVELLDRLEPEDVIVVDRKDNASTFHRLDAVQ
FT                   LQDWLDDYSLGDLWKQNVLGGRPA"
     MAGVTKLTIA GFKSIRELRD FELRNLNVLI GANGAGKSNF IGFFKLLAEM YERRLQLFVQ        60
     QQGGSDTLLH FSRKLTDKIE GELNFGTDYD HYRFELVVTN DNRLIFTNEQ YWLHSRGSRP       120
     GEVGLLGGNK DESDLKKLAA QQKSPLIDDI LNSTRVYHFH DTGEKAKVKQ PHALNDTLRL       180
     KVDGANLAAY LRMLKTEHAE SYRQIVDTIR LVAPFFDDFV FRADSASKIQ LEWTERGDPD       240
     TPFTAHALSD GTLRFICLGT LLLQPWELMP ATILIDEPEL GLHPYAINLL ADLLKRASEQ       300
     KQLIVSTQSV ELLDRLEPED VIVVDRKDNA STFHRLDAVQ LQDWLDDYSL GDLWKQNVLG       360
     GRPA                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page