(data stored in ACNUC7421 zone)

EMBL: CP000270.PE225

CP000270.PE225       Location/Qualifiers
FT   CDS             complement(261435..262736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4237"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28763"
FT                   /db_xref="GOA:Q146H6"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H6"
FT                   /protein_id="ABE28763.1"
FT                   /translation="MSTAPAARRSDRTPPSGPRTGWRAGRWIAVLLIVAVLHWIAAQWV
FT                   ERNRATLNPSDDGHVPVQVALLTPERVERNPAAAASSTPEPAPARRTAAHKPREPVLTA
FT                   LQPAKQAAPATPAATSDAVASAPDAAGANAAPNAAAGAASTAASAPAPASAPQASPGVK
FT                   FSVPPSGELQYDTFYNGVRNQPGTIHWTSSAQSYEMVVSVPLPFVGTFVYSSHGRIDAF
FT                   GLAPDQYIEKRGRRAEDIAIFNRTDRKIAFTRTPAALPLPDGAQDRFSMVMQLASLVRG
FT                   DPAAYKPGVTRQFFVVDNDSGENWPVETIGDETIRTDQGFLDTRHFKRLPRRDGDLRRI
FT                   DVWLAPSLGWLPARIVQTEPNGTQFELVWRGKLNAGNAGSPPENNGDAGAASPDNPGGS
FT                   SPSASPAVTPGAAPSSPSPVDSTSPADTPGIIKP"
     MSTAPAARRS DRTPPSGPRT GWRAGRWIAV LLIVAVLHWI AAQWVERNRA TLNPSDDGHV        60
     PVQVALLTPE RVERNPAAAA SSTPEPAPAR RTAAHKPREP VLTALQPAKQ AAPATPAATS       120
     DAVASAPDAA GANAAPNAAA GAASTAASAP APASAPQASP GVKFSVPPSG ELQYDTFYNG       180
     VRNQPGTIHW TSSAQSYEMV VSVPLPFVGT FVYSSHGRID AFGLAPDQYI EKRGRRAEDI       240
     AIFNRTDRKI AFTRTPAALP LPDGAQDRFS MVMQLASLVR GDPAAYKPGV TRQFFVVDND       300
     SGENWPVETI GDETIRTDQG FLDTRHFKRL PRRDGDLRRI DVWLAPSLGW LPARIVQTEP       360
     NGTQFELVWR GKLNAGNAGS PPENNGDAGA ASPDNPGGSS PSASPAVTPG AAPSSPSPVD       420
     STSPADTPGI IKP                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page