(data stored in ACNUC7421 zone)

EMBL: CP000270.PE237

CP000270.PE237       Location/Qualifiers
FT   CDS             272748..273881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4225"
FT                   /product="Putative ABC transporter, inner membrane subunit"
FT                   /function="resistance to organic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28775"
FT                   /db_xref="GOA:Q146G4"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G4"
FT                   /protein_id="ABE28775.1"
FT                   /translation="MNYDTPPGLEVAAGSQGKIVRLSGQWTALALARDRATGHVIPLLL
FT                   SLVGAEGIGGWDLSRIDRMDHVGGQALWRVWGHKMPADTTLTDTQRDIFERIALLDTVR
FT                   ETAEPVIKLDPFTRLGLAIFSFFEHLYGGVAMLGRVVLDLLAIVRKPKITPWTEISANV
FT                   YNAGTQALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAIL
FT                   VAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIA
FT                   LTGGALAARIVLGIDMSYFARALPGVVPVANLWIGLGKGVVFGMLIAIVGCHFGFRIKA
FT                   NSQSLGEGTTTSVVTSITIVILADAVFAILFQNVGLG"
     MNYDTPPGLE VAAGSQGKIV RLSGQWTALA LARDRATGHV IPLLLSLVGA EGIGGWDLSR        60
     IDRMDHVGGQ ALWRVWGHKM PADTTLTDTQ RDIFERIALL DTVRETAEPV IKLDPFTRLG       120
     LAIFSFFEHL YGGVAMLGRV VLDLLAIVRK PKITPWTEIS ANVYNAGTQA LPITALVAFL       180
     IGIVLSYLSA QQLRLFGANQ YIVNILGLSV IRELGPVLSA ILVAGRSGSA ITAQIGVMRV       240
     TEELDAMRVM GIPHGLRLIL PRVLALGVAM PLLVMWTNII ALTGGALAAR IVLGIDMSYF       300
     ARALPGVVPV ANLWIGLGKG VVFGMLIAIV GCHFGFRIKA NSQSLGEGTT TSVVTSITIV       360
     ILADAVFAIL FQNVGLG                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page