(data stored in ACNUC7421 zone)

EMBL: CP000270.PE239

CP000270.PE239       Location/Qualifiers
FT   CDS             274773..275735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4223"
FT                   /product="ABC transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28777"
FT                   /db_xref="GOA:Q146G2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G2"
FT                   /protein_id="ABE28777.1"
FT                   /translation="MENKSHAFWAGLFTVVLLAAIAVAAFLFNVDRSVRVPYDLIARTN
FT                   VTGLYTDAAVRYRGLDVGKVQSIKFDPDHPGQILIRILVDTHAPITHSTFGSLGFQGVT
FT                   GIAFIQLDDNGRDPSPLPSSDKQVAQLPMRPGLLDQLQQRGDVLLRKLEKVANDVDNLL
FT                   SPEMAAQLQGTAASLQKAADGVATLTQQFAPAAGKLPGTIDQLDRTLASTNQLITGLNR
FT                   PDGPFETNLNKVGTAAQQAGDALTSMNGSLQELSARVGYDTLPRVNSLAEDVRSAARSV
FT                   DRAADTFSTSPRSVLFGAPGAAPGPGEAGFKWPAPRAAR"
     MENKSHAFWA GLFTVVLLAA IAVAAFLFNV DRSVRVPYDL IARTNVTGLY TDAAVRYRGL        60
     DVGKVQSIKF DPDHPGQILI RILVDTHAPI THSTFGSLGF QGVTGIAFIQ LDDNGRDPSP       120
     LPSSDKQVAQ LPMRPGLLDQ LQQRGDVLLR KLEKVANDVD NLLSPEMAAQ LQGTAASLQK       180
     AADGVATLTQ QFAPAAGKLP GTIDQLDRTL ASTNQLITGL NRPDGPFETN LNKVGTAAQQ       240
     AGDALTSMNG SLQELSARVG YDTLPRVNSL AEDVRSAARS VDRAADTFST SPRSVLFGAP       300
     GAAPGPGEAG FKWPAPRAAR                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page