(data stored in ACNUC7421 zone)

EMBL: CP000270.PE240

CP000270.PE240       Location/Qualifiers
FT   CDS             275766..276392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4222"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28778"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G1"
FT                   /protein_id="ABE28778.1"
FT                   /translation="MSRSIHRLLSSSAALAVLLAFGVLATGCAGTPAAISDIRYDFGPP
FT                   APAASAGTSPAVKVLDVTAPDVLESDKLMYRLSYADAQQTASYANSHWTMTPSQLLTQR
FT                   LRGALSSRGTVLTGADGVSAPVLKVELSEFEQVFDSQSKSHAAVTARATLTQGGKVLGQ
FT                   RTFIARAPSSSGDAAGGAQALATASDDLVAQIGAWLGVQALVAAQ"
     MSRSIHRLLS SSAALAVLLA FGVLATGCAG TPAAISDIRY DFGPPAPAAS AGTSPAVKVL        60
     DVTAPDVLES DKLMYRLSYA DAQQTASYAN SHWTMTPSQL LTQRLRGALS SRGTVLTGAD       120
     GVSAPVLKVE LSEFEQVFDS QSKSHAAVTA RATLTQGGKV LGQRTFIARA PSSSGDAAGG       180
     AQALATASDD LVAQIGAWLG VQALVAAQ                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page