(data stored in ACNUC7421 zone)

EMBL: CP000270.PE245

CP000270.PE245       Location/Qualifiers
FT   CDS             280347..281312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4217"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28783"
FT                   /db_xref="GOA:Q146F6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F6"
FT                   /protein_id="ABE28783.1"
FT                   /translation="MTAVSDVSSDPIVYLNGELVPLSEARVPVLDRGFIFGDGIYEVAP
FT                   LYAHPAHAGGRTPFRFQQHLARLARSVDRIGIVNPLNDAGWRALIAQVVAANEAGGGLR
FT                   AGQDAIAYIQVTRGVAKRGHAFPAGIQPTVFVMVTPLSLPDAAQRAQGVRCVTAEDRRW
FT                   LNCDIKSVSLLGNVLMAQYAAENDAFETIQFRDGMLTEGSSSNVWMVKDGVLSAPPRSH
FT                   KILEGIRYGLIEELAGECGIRFEAREISEAELRAADEILVSSATKEVLPVAQIDGQPVG
FT                   EGKPGAVFAALYAAYQRAKTQEAREARQGVENESRERITV"
     MTAVSDVSSD PIVYLNGELV PLSEARVPVL DRGFIFGDGI YEVAPLYAHP AHAGGRTPFR        60
     FQQHLARLAR SVDRIGIVNP LNDAGWRALI AQVVAANEAG GGLRAGQDAI AYIQVTRGVA       120
     KRGHAFPAGI QPTVFVMVTP LSLPDAAQRA QGVRCVTAED RRWLNCDIKS VSLLGNVLMA       180
     QYAAENDAFE TIQFRDGMLT EGSSSNVWMV KDGVLSAPPR SHKILEGIRY GLIEELAGEC       240
     GIRFEAREIS EAELRAADEI LVSSATKEVL PVAQIDGQPV GEGKPGAVFA ALYAAYQRAK       300
     TQEAREARQG VENESRERIT V                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page