(data stored in ACNUC7421 zone)

EMBL: CP000270.PE246

CP000270.PE246       Location/Qualifiers
FT   CDS             281341..281553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4216"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28784"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F5"
FT                   /protein_id="ABE28784.1"
FT                   /translation="MGKSHPEFAETIVTVVQQFDNEVDVSRVEMRPSSGGNYTGLTVTV
FT                   RATSREQLDDIYRALTGHPMVKVVL"
     MGKSHPEFAE TIVTVVQQFD NEVDVSRVEM RPSSGGNYTG LTVTVRATSR EQLDDIYRAL        60
     TGHPMVKVVL                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page