(data stored in ACNUC7421 zone)

EMBL: CP000270.PE252

CP000270.PE252       Location/Qualifiers
FT   CDS             complement(285280..285813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28790"
FT                   /db_xref="GOA:Q146E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E9"
FT                   /protein_id="ABE28790.1"
FT                   /translation="MPRLGASWPFGRLTSSRPRQDHLCVAKLRIPMIEFFSRLSWLFFN
FT                   VGVPVCAPFALLPLLSFSRFYRQSSKGIAIRSVQDGQLLWVVISMCAGACYEIGSALSG
FT                   ASTKNTLAFMLAGLLWHVLFMVAACILVSFGAADSTPHGGCGDEPPERRLMWTSVIMTA
FT                   TIAATFALSHYSLT"
     MPRLGASWPF GRLTSSRPRQ DHLCVAKLRI PMIEFFSRLS WLFFNVGVPV CAPFALLPLL        60
     SFSRFYRQSS KGIAIRSVQD GQLLWVVISM CAGACYEIGS ALSGASTKNT LAFMLAGLLW       120
     HVLFMVAACI LVSFGAADST PHGGCGDEPP ERRLMWTSVI MTATIAATFA LSHYSLT          177
//

If you have problems or comments...

PBIL Back to PBIL home page