(data stored in ACNUC7421 zone)

EMBL: CP000270.PE263

CP000270.PE263       Location/Qualifiers
FT   CDS             295912..296703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4199"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   innermembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28801"
FT                   /db_xref="GOA:Q146D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D8"
FT                   /protein_id="ABE28801.1"
FT                   /translation="MKSQSRVGAWTAMIVGSLYFLIPLIATFEFSLRMKRGAYSFEAYS
FT                   VVLGDPRFQASFGYSILMALLTIVVGVLLVVPTAYWVQLRLPKLRPVVEFITLLPLVVP
FT                   AIVIVFGYLRIYNSSSILPLTGNERATDLLLVFGYVTLSLPYMYRAVDAGLRAVDVRSL
FT                   TEAAECLGASWPTILFKVIFPNIRSGILSGAFLTFAVVIGEFTLASLLDRPAFGPYLQL
FT                   IGANRAYEPSALAIIAFVITWASMGLIQVFGSARAMSGQKV"
     MKSQSRVGAW TAMIVGSLYF LIPLIATFEF SLRMKRGAYS FEAYSVVLGD PRFQASFGYS        60
     ILMALLTIVV GVLLVVPTAY WVQLRLPKLR PVVEFITLLP LVVPAIVIVF GYLRIYNSSS       120
     ILPLTGNERA TDLLLVFGYV TLSLPYMYRA VDAGLRAVDV RSLTEAAECL GASWPTILFK       180
     VIFPNIRSGI LSGAFLTFAV VIGEFTLASL LDRPAFGPYL QLIGANRAYE PSALAIIAFV       240
     ITWASMGLIQ VFGSARAMSG QKV                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page