(data stored in ACNUC7421 zone)

EMBL: CP000270.PE270

CP000270.PE270       Location/Qualifiers
FT   CDS             complement(304789..306378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4192"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28808"
FT                   /db_xref="GOA:Q146D1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D1"
FT                   /protein_id="ABE28808.1"
FT                   /translation="MSLAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRES
FT                   RERVRAALQNCNFDFPVRRITVNLAPADLPKESGRFDLPIALGILAASGQIPAESLLHR
FT                   EFAGELSLTGALRPMRGAFAMACGTARGGVSHGGAASGISGELAASEPAAHPVPQLYLP
FT                   AASAAEAALVPGVDVYGAADLPSLCAHLADAPDARLHPLAAPELADCASAADPDMGDVI
FT                   GQRGARRALEVAAAGGHHVLLVGPPGAGKSMLAARLPGLLPPMTDDEALSSAALLSASR
FT                   AGFTPSQWRRRPFRAPHHSSSAAALVGGRNPPQPGEITLAHLGVLFLDELPEFDRAVLE
FT                   TLREPLEAGRITISRAALQADFPAACQLIAAMNPCPCGWRGDPQGRCRCTPEIAARYLR
FT                   KLSGPLLDRIDIQLEIPALTPAELSARSTAVGETSAAIAARVNRARERQLSRQGKTNRE
FT                   LGGREVDEMCQPDAAGEILLREAGERFGWSARAYYRVLKVARTIADLAGAPMPSAAQIA
FT                   EAIQYRRAFGSV"
     MSLAVVRSRA PAAGRAPEVT VEVHLANGLP SFSIVGLPDL EVRESRERVR AALQNCNFDF        60
     PVRRITVNLA PADLPKESGR FDLPIALGIL AASGQIPAES LLHREFAGEL SLTGALRPMR       120
     GAFAMACGTA RGGVSHGGAA SGISGELAAS EPAAHPVPQL YLPAASAAEA ALVPGVDVYG       180
     AADLPSLCAH LADAPDARLH PLAAPELADC ASAADPDMGD VIGQRGARRA LEVAAAGGHH       240
     VLLVGPPGAG KSMLAARLPG LLPPMTDDEA LSSAALLSAS RAGFTPSQWR RRPFRAPHHS       300
     SSAAALVGGR NPPQPGEITL AHLGVLFLDE LPEFDRAVLE TLREPLEAGR ITISRAALQA       360
     DFPAACQLIA AMNPCPCGWR GDPQGRCRCT PEIAARYLRK LSGPLLDRID IQLEIPALTP       420
     AELSARSTAV GETSAAIAAR VNRARERQLS RQGKTNRELG GREVDEMCQP DAAGEILLRE       480
     AGERFGWSAR AYYRVLKVAR TIADLAGAPM PSAAQIAEAI QYRRAFGSV                   529
//

If you have problems or comments...

PBIL Back to PBIL home page