(data stored in ACNUC7421 zone)

EMBL: CP000270.PE278

CP000270.PE278       Location/Qualifiers
FT   CDS             313061..314866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4184"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28816"
FT                   /db_xref="GOA:Q146C3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C3"
FT                   /protein_id="ABE28816.1"
FT                   /translation="MSESIAAVCRGITQLEEVRVSFTLHGIPVSRGIAIGRAYLIAPAA
FT                   LDVDHYLIEPAQIDGEVERFRAAQQHVHRELDALRADLAADAPSEMGAFINVHSMILND
FT                   AMLVQETIDLIRTRRYNVEWALTEQLERLSRHFDDIEDEYLRERKADIEQVVERVLKAL
FT                   AGASVALVDGVHGACDEMIVVAHDIAPADMMQFKTQTFQGFVTDLGGRTSHTAIVARSL
FT                   GIPAAVGVQHASALIRQDDLIIVDGDHGIVIVDPAPIVLEEYSYRQSEKALEQRKLQRL
FT                   KFSPTQTLCGTRIELCANIELPEDARAALEAGAMGVGLFRSEFLFMNHKDRLPEEEEQF
FT                   AAYRRAVELMNGLPVTIRTIDVGADKPLDSMGGGDGYETAANPALGLRAIRWSLSEPQM
FT                   FLTQLRAILRASAFGTVKILIPMLAHAQEIDQTLDLIREAKRQLDDAGIAYDPNVQVGA
FT                   MIEIPAAAIALPLFLKRLDFLSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLHLIAF
FT                   TLREAKRAGVPVSVCGEMAGDPALTRLLLGMGLTEFSMHPSQLLVVKQEVLRAHLKTLE
FT                   KPVADVLASFEPEEVQAALKRVTLA"
     MSESIAAVCR GITQLEEVRV SFTLHGIPVS RGIAIGRAYL IAPAALDVDH YLIEPAQIDG        60
     EVERFRAAQQ HVHRELDALR ADLAADAPSE MGAFINVHSM ILNDAMLVQE TIDLIRTRRY       120
     NVEWALTEQL ERLSRHFDDI EDEYLRERKA DIEQVVERVL KALAGASVAL VDGVHGACDE       180
     MIVVAHDIAP ADMMQFKTQT FQGFVTDLGG RTSHTAIVAR SLGIPAAVGV QHASALIRQD       240
     DLIIVDGDHG IVIVDPAPIV LEEYSYRQSE KALEQRKLQR LKFSPTQTLC GTRIELCANI       300
     ELPEDARAAL EAGAMGVGLF RSEFLFMNHK DRLPEEEEQF AAYRRAVELM NGLPVTIRTI       360
     DVGADKPLDS MGGGDGYETA ANPALGLRAI RWSLSEPQMF LTQLRAILRA SAFGTVKILI       420
     PMLAHAQEID QTLDLIREAK RQLDDAGIAY DPNVQVGAMI EIPAAAIALP LFLKRLDFLS       480
     IGTNDLIQYT LAIDRADNAV AHLYDPLHPA VLHLIAFTLR EAKRAGVPVS VCGEMAGDPA       540
     LTRLLLGMGL TEFSMHPSQL LVVKQEVLRA HLKTLEKPVA DVLASFEPEE VQAALKRVTL       600
     A                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page