(data stored in ACNUC7421 zone)

EMBL: CP000270.PE286

CP000270.PE286       Location/Qualifiers
FT   CDS             321115..321663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4176"
FT                   /product="Putative appr-1-p processing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28824"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B5"
FT                   /protein_id="ABE28824.1"
FT                   /translation="MLRFNRCTLEARVVDITELAVDAIVNAANTSLLGGGGVDGAIHRA
FT                   AGKELIRECETLGGCATGDAKLTRGYRLPARYVIHAVGPRWRGGGHGEADLLASCYQRS
FT                   LEVAREAQCTSIAFPAISCGIYHFPADEAVRIALGTVLATLPRTPQIEQVVFACFDDAM
FT                   FARYEAELMRRQAPPSKPV"
     MLRFNRCTLE ARVVDITELA VDAIVNAANT SLLGGGGVDG AIHRAAGKEL IRECETLGGC        60
     ATGDAKLTRG YRLPARYVIH AVGPRWRGGG HGEADLLASC YQRSLEVARE AQCTSIAFPA       120
     ISCGIYHFPA DEAVRIALGT VLATLPRTPQ IEQVVFACFD DAMFARYEAE LMRRQAPPSK       180
     PV                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page