(data stored in ACNUC7421 zone)

EMBL: CP000270.PE288

CP000270.PE288       Location/Qualifiers
FT   CDS             complement(322125..322910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4174"
FT                   /product="Putative competence protein f-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28826"
FT                   /db_xref="GOA:Q146B3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B3"
FT                   /protein_id="ABE28826.1"
FT                   /translation="MPLRSISSFSGSRFARFARAVHSAWPRVAQVALPNLCALCGNLSH
FT                   TTICAGCDAAYWNEERLRCTVCAVPLSVTQWAARTQYRCADCAGEPPPFDATFALADYR
FT                   APLDTLAVGLKFRARLMLAHEFGQRLARLAQDSWLELAEWPDVIAPVPLARKRLVERGY
FT                   NQAWQIARPLARALHVRSDATLLHRVIHTAPQSRLDLDARRLNVGRAFKVAGSVQGLHV
FT                   GIVDDVMTTGATLEALARTLKAAGARQVTNFVALRTPKN"
     MPLRSISSFS GSRFARFARA VHSAWPRVAQ VALPNLCALC GNLSHTTICA GCDAAYWNEE        60
     RLRCTVCAVP LSVTQWAART QYRCADCAGE PPPFDATFAL ADYRAPLDTL AVGLKFRARL       120
     MLAHEFGQRL ARLAQDSWLE LAEWPDVIAP VPLARKRLVE RGYNQAWQIA RPLARALHVR       180
     SDATLLHRVI HTAPQSRLDL DARRLNVGRA FKVAGSVQGL HVGIVDDVMT TGATLEALAR       240
     TLKAAGARQV TNFVALRTPK N                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page