(data stored in ACNUC7421 zone)

EMBL: CP000270.PE289

CP000270.PE289       Location/Qualifiers
FT   CDS             322944..323960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4173"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28827"
FT                   /db_xref="GOA:Q146B2"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B2"
FT                   /protein_id="ABE28827.1"
FT                   /translation="MEGNERVYFGLYASTTLMSPTPAQSGRPAYDSQRLRRIFDRRAST
FT                   FSEVAFLPREIAQRMRERLDYIKVTPSSVLDAGCGMGEDIPALRERFPEAPVFGSDLSH
FT                   GMLTRALQHDSGDTSWRRFLPATLGKALGARGPRFAQADFSALPFAAGAFEFIWSNLAL
FT                   HWHSRPDLVFPEWQRVLKVNGLLMFSTLGPDSLKELRGAYAEVEAAHGVASRKHVIDFV
FT                   DMHDLGDMLVESGFEIPVMDQEVLTITYKSPESLLADVRRWGAYPFEREASSGAVARRL
FT                   HKALLAALEARRRADGTLALTFEVIYGHAWKAVPRTTAEGHGIVRIEDIGRGSARNR"
     MEGNERVYFG LYASTTLMSP TPAQSGRPAY DSQRLRRIFD RRASTFSEVA FLPREIAQRM        60
     RERLDYIKVT PSSVLDAGCG MGEDIPALRE RFPEAPVFGS DLSHGMLTRA LQHDSGDTSW       120
     RRFLPATLGK ALGARGPRFA QADFSALPFA AGAFEFIWSN LALHWHSRPD LVFPEWQRVL       180
     KVNGLLMFST LGPDSLKELR GAYAEVEAAH GVASRKHVID FVDMHDLGDM LVESGFEIPV       240
     MDQEVLTITY KSPESLLADV RRWGAYPFER EASSGAVARR LHKALLAALE ARRRADGTLA       300
     LTFEVIYGHA WKAVPRTTAE GHGIVRIEDI GRGSARNR                               338
//

If you have problems or comments...

PBIL Back to PBIL home page