(data stored in ACNUC7421 zone)

EMBL: CP000270.PE29

CP000270.PE29        Location/Qualifiers
FT   CDS             36117..36911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4434"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28567"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C2"
FT                   /protein_id="ABE28567.1"
FT                   /translation="MKLLKPLLALACAFASLAAASAVSAADTSTLRFGLEAQYPPFESK
FT                   GPNGELQGLDIDVGNAVCAAAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATEQRRQ
FT                   AIDFTTVVYRVPTQLIAKRDSGLLPTTASLKGKRVGVLQSSIQETFAKAHWESAGVTVV
FT                   PYQDQNQVYTDLVAGRLDATLVLAPAGQTGFLSKPNGAGYAFVGEPVRDDRILGSGIAY
FT                   GIRKGDTALRDRLNAAIAKVQADGTVKTLATKYLGNIDVTAK"
     MKLLKPLLAL ACAFASLAAA SAVSAADTST LRFGLEAQYP PFESKGPNGE LQGLDIDVGN        60
     AVCAAAHMTC KWVETSFDGL IPALQGRKFD AINSAMNATE QRRQAIDFTT VVYRVPTQLI       120
     AKRDSGLLPT TASLKGKRVG VLQSSIQETF AKAHWESAGV TVVPYQDQNQ VYTDLVAGRL       180
     DATLVLAPAG QTGFLSKPNG AGYAFVGEPV RDDRILGSGI AYGIRKGDTA LRDRLNAAIA       240
     KVQADGTVKT LATKYLGNID VTAK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page