(data stored in ACNUC7421 zone)

EMBL: CP000270.PE293

CP000270.PE293       Location/Qualifiers
FT   CDS             328368..328982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4169"
FT                   /product="Putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28831"
FT                   /db_xref="GOA:Q146A8"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A8"
FT                   /protein_id="ABE28831.1"
FT                   /translation="MSTQPPAQADRSFNRPMLIKLFIVALMMFGFGFALVPMYRAICQI
FT                   TGINNLVQRDVTVREAKNTQVDMSRTISIEFDANARGPLGFKPEQRSLDVHPGEVTTVM
FT                   YEVSNEQARTIQAQAIPSYAPKQATEYFRKIECFCFTQQTLTANQTKRMPVVFVVDPKL
FT                   PKDVKTITLSYTFFELNTPVSATAGSAAPTANTAATAANPA"
     MSTQPPAQAD RSFNRPMLIK LFIVALMMFG FGFALVPMYR AICQITGINN LVQRDVTVRE        60
     AKNTQVDMSR TISIEFDANA RGPLGFKPEQ RSLDVHPGEV TTVMYEVSNE QARTIQAQAI       120
     PSYAPKQATE YFRKIECFCF TQQTLTANQT KRMPVVFVVD PKLPKDVKTI TLSYTFFELN       180
     TPVSATAGSA APTANTAATA ANPA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page