(data stored in ACNUC7421 zone)

EMBL: CP000270.PE295

CP000270.PE295       Location/Qualifiers
FT   CDS             329359..330216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4167"
FT                   /product="Putative cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28833"
FT                   /db_xref="GOA:Q146A6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A6"
FT                   /protein_id="ABE28833.1"
FT                   /translation="MSGQNESPYYFVPHPSRHPISAAAGLLVMLGSLAAWINEHDWAPI
FT                   GVVAGLLWLLFTLWHWFGDAIAESEGGMYGKNVDKSYRWSMSWFIFSEVMFFGAFFGAL
FT                   FYAREIALHQLGSLDYKLIWPDFSAVWPNNGPAALVSTFKSMQPWPVPTINTALLLSSG
FT                   ATLTVSHHALRENHRKKAIIWLAATLVLGVCFLFLQGFEYFHAYNELNLTLSSGVYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLVRMIRGHFTADHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
     MSGQNESPYY FVPHPSRHPI SAAAGLLVML GSLAAWINEH DWAPIGVVAG LLWLLFTLWH        60
     WFGDAIAESE GGMYGKNVDK SYRWSMSWFI FSEVMFFGAF FGALFYAREI ALHQLGSLDY       120
     KLIWPDFSAV WPNNGPAALV STFKSMQPWP VPTINTALLL SSGATLTVSH HALRENHRKK       180
     AIIWLAATLV LGVCFLFLQG FEYFHAYNEL NLTLSSGVYG STFFLLTGFH GFHVFLGGTM       240
     LAVVLVRMIR GHFTADHHFA FEGAAWYWHF VDVVWLGLYV VVYWL                       285
//

If you have problems or comments...

PBIL Back to PBIL home page