(data stored in ACNUC7421 zone)

EMBL: CP000270.PE297

CP000270.PE297       Location/Qualifiers
FT   CDS             330701..331417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4165"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28835"
FT                   /db_xref="GOA:Q146A4"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A4"
FT                   /protein_id="ABE28835.1"
FT                   /translation="MKIRLVPALLILLVIVVTVRLGFWQRDRAHQKEALEARITQFENA
FT                   PAQPVSAAPVELKDIEFHHVKARGSFVADKVVYLDNRPYNDQPGFYVVMPFKLADGGYV
FT                   LVNRGWLPRNMNNRETIAPYTTPQGEIEIEGIARADASRAFELGQGGSAEHQLIRQNLD
FT                   TAAYAAETGLPLQSFVIQQLSDDGDQLVRDWPAPTNGVERNYGYMFQWWGMAAAALVFG
FT                   LYAARRAAKKEHAPGV"
     MKIRLVPALL ILLVIVVTVR LGFWQRDRAH QKEALEARIT QFENAPAQPV SAAPVELKDI        60
     EFHHVKARGS FVADKVVYLD NRPYNDQPGF YVVMPFKLAD GGYVLVNRGW LPRNMNNRET       120
     IAPYTTPQGE IEIEGIARAD ASRAFELGQG GSAEHQLIRQ NLDTAAYAAE TGLPLQSFVI       180
     QQLSDDGDQL VRDWPAPTNG VERNYGYMFQ WWGMAAAALV FGLYAARRAA KKEHAPGV         238
//

If you have problems or comments...

PBIL Back to PBIL home page