(data stored in ACNUC7421 zone)

EMBL: CP000270.PE301

CP000270.PE301       Location/Qualifiers
FT   CDS             334198..334815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4161"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28839"
FT                   /db_xref="GOA:Q146A0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A0"
FT                   /protein_id="ABE28839.1"
FT                   /translation="MLKNRFARTARAAVIACALGGALLVAGCGKQPPAFQNLDITGNTQ
FT                   FASNFSLPDTSGHIRTMADYKGKVVVLFFGYTHCPDVCPTTMAELSQALQQLGPEDAKR
FT                   VQVLFVTVDPERDTPALLAQYVPAFNPTFVGLRPADQAQLTRITKDFRVYYAKVPGKTP
FT                   DSYTMDHTAASYVFDTDGKLRLFARDGQGATPWVHDIKLLLD"
     MLKNRFARTA RAAVIACALG GALLVAGCGK QPPAFQNLDI TGNTQFASNF SLPDTSGHIR        60
     TMADYKGKVV VLFFGYTHCP DVCPTTMAEL SQALQQLGPE DAKRVQVLFV TVDPERDTPA       120
     LLAQYVPAFN PTFVGLRPAD QAQLTRITKD FRVYYAKVPG KTPDSYTMDH TAASYVFDTD       180
     GKLRLFARDG QGATPWVHDI KLLLD                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page