(data stored in ACNUC7421 zone)

EMBL: CP000270.PE304

CP000270.PE304       Location/Qualifiers
FT   CDS             337532..338344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4158"
FT                   /product="ABC transporter, periplasmic ligand binding
FT                   protein, YaeC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28842"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z7"
FT                   /protein_id="ABE28842.1"
FT                   /translation="MQRRNILKALSAVIAGAAIVTSFGAHADDKVIKVGTIGGPDAQIW
FT                   EVVTKVAKREGLNVKVVEFNDYVQPNAALDAGDLDANSFQHQPYLDSQIKQRGYRIVNV
FT                   GLTYISPLGIYSKKLKSLKDLPQGAKVAVPNDPSNENRALLLLQTQGVIKLKAGAGTNG
FT                   NNATPLDVAENPKKIKLIELDAAQLPRSLSDVDAAAINTNFALAAGLQPTRDAIALEDV
FT                   HSPYANLIAVRTQDKDKPWVRKLVAAYQSEDVRQFIKTQFKGSVVPSF"
     MQRRNILKAL SAVIAGAAIV TSFGAHADDK VIKVGTIGGP DAQIWEVVTK VAKREGLNVK        60
     VVEFNDYVQP NAALDAGDLD ANSFQHQPYL DSQIKQRGYR IVNVGLTYIS PLGIYSKKLK       120
     SLKDLPQGAK VAVPNDPSNE NRALLLLQTQ GVIKLKAGAG TNGNNATPLD VAENPKKIKL       180
     IELDAAQLPR SLSDVDAAAI NTNFALAAGL QPTRDAIALE DVHSPYANLI AVRTQDKDKP       240
     WVRKLVAAYQ SEDVRQFIKT QFKGSVVPSF                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page