(data stored in ACNUC7421 zone)

EMBL: CP000270.PE311

CP000270.PE311       Location/Qualifiers
FT   CDS             347329..348651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4151"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28849"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z0"
FT                   /protein_id="ABE28849.1"
FT                   /translation="MSMRSAICLMFFLPAGVAYAGGQFNVQCAYSHTLPDDAIIYPGQP
FT                   GRAMVHDFFGNTGADAYSTYYSLNDNKVSTCNVAADPSSYWVPQLKRASGIVVPGYQKT
FT                   YYKNDQPVVPLHTIPAGLEMLAGDHRSSSPKPQINYLCRGGSYTQIAPTRCPVVTDSSG
FT                   TYAQLDISVHFPDCWDGRTLVPSMASHIMNMAYRQADGKCPAAYPVKIPELQLNVAYDL
FT                   GQDPDLSTAQLSMDPILVNGTWVPQWGSLYTAHADFINAWKIDSLQYAVDNCSNADIAC
FT                   SNSIPTYYSKASADVWMDGSGVAHASDSTMISDAASTVLIKFPTPTDLKDYPYTNSYLQ
FT                   TLAQNVTDTSAVTLDIYAASTNWNDTANLPTTAACNTNQRIGGIYLDNALQPRINDITR
FT                   YVASQVAAGASQIGVCIRNATGRTVQISSRDGTRTPALFMK"
     MSMRSAICLM FFLPAGVAYA GGQFNVQCAY SHTLPDDAII YPGQPGRAMV HDFFGNTGAD        60
     AYSTYYSLND NKVSTCNVAA DPSSYWVPQL KRASGIVVPG YQKTYYKNDQ PVVPLHTIPA       120
     GLEMLAGDHR SSSPKPQINY LCRGGSYTQI APTRCPVVTD SSGTYAQLDI SVHFPDCWDG       180
     RTLVPSMASH IMNMAYRQAD GKCPAAYPVK IPELQLNVAY DLGQDPDLST AQLSMDPILV       240
     NGTWVPQWGS LYTAHADFIN AWKIDSLQYA VDNCSNADIA CSNSIPTYYS KASADVWMDG       300
     SGVAHASDST MISDAASTVL IKFPTPTDLK DYPYTNSYLQ TLAQNVTDTS AVTLDIYAAS       360
     TNWNDTANLP TTAACNTNQR IGGIYLDNAL QPRINDITRY VASQVAAGAS QIGVCIRNAT       420
     GRTVQISSRD GTRTPALFMK                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page