(data stored in ACNUC7421 zone)

EMBL: CP000270.PE313

CP000270.PE313       Location/Qualifiers
FT   CDS             complement(348917..350053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4149"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28851"
FT                   /db_xref="GOA:Q145Y8"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y8"
FT                   /protein_id="ABE28851.1"
FT                   /translation="MDYATLKLIWWVLIGVLLIGFALTDGFDMGAAILLPFIGKTDAER
FT                   RIVVNTVGATWEGNQVWLITAGGAMFAAWPLVYAASFSGFYFAMLLVLFSLFFRPVGFD
FT                   YRSKREDPRWRSAWDWALFVGGFVPALVFGVAFGNLLQGVPFSFDTDLRVTYHGGFFAL
FT                   LNPFAVLCGLVSVSMLAAHGAAFVKMKADDIVAERASLALRIASFAAVVLFLIAGALIA
FT                   TMIGGYQLVDAAPLDTVANPLLKSVTGAPGLWLANYATYPWMVAAPVAGLAGGVLATLL
FT                   ARSRFEKSAFLATSLMIIGVILTAGFSMFPFIMPSSLDGRSSLTVWDSTSSRMTLQIML
FT                   IAVIVFLPLILIYTSWVYRVMRGKVTAAALEENHHSMY"
     MDYATLKLIW WVLIGVLLIG FALTDGFDMG AAILLPFIGK TDAERRIVVN TVGATWEGNQ        60
     VWLITAGGAM FAAWPLVYAA SFSGFYFAML LVLFSLFFRP VGFDYRSKRE DPRWRSAWDW       120
     ALFVGGFVPA LVFGVAFGNL LQGVPFSFDT DLRVTYHGGF FALLNPFAVL CGLVSVSMLA       180
     AHGAAFVKMK ADDIVAERAS LALRIASFAA VVLFLIAGAL IATMIGGYQL VDAAPLDTVA       240
     NPLLKSVTGA PGLWLANYAT YPWMVAAPVA GLAGGVLATL LARSRFEKSA FLATSLMIIG       300
     VILTAGFSMF PFIMPSSLDG RSSLTVWDST SSRMTLQIML IAVIVFLPLI LIYTSWVYRV       360
     MRGKVTAAAL EENHHSMY                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page