(data stored in ACNUC7421 zone)

EMBL: CP000270.PE315

CP000270.PE315       Location/Qualifiers
FT   CDS             complement(351686..351946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4147"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28853"
FT                   /db_xref="GOA:Q145Y6"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y6"
FT                   /protein_id="ABE28853.1"
FT                   /translation="MTIALNRNTIRRPSLRKRFDGWVRGPTLARDIAIVLAIKFALLMV
FT                   LKYTFFNHPQAENMSLPPEQVAQALLSVPASHPSQGDQHAR"
     MTIALNRNTI RRPSLRKRFD GWVRGPTLAR DIAIVLAIKF ALLMVLKYTF FNHPQAENMS        60
     LPPEQVAQAL LSVPASHPSQ GDQHAR                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page