(data stored in ACNUC7421 zone)

EMBL: CP000270.PE316

CP000270.PE316       Location/Qualifiers
FT   CDS             complement(352292..353215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4146"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28854"
FT                   /db_xref="GOA:Q145Y5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y5"
FT                   /protein_id="ABE28854.1"
FT                   /translation="MTLPSTLSPSSAKAASAGALALSHSSLLPGQLGNIDAYIQAVNRI
FT                   PMLTPAEERQFATEFREQDNLESARRLVLSHLRLVVSIARNYLGYGLPHADLIQEGNIG
FT                   LMKAVKRFDPEQNVRLVSYAMHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLRSHKQ
FT                   GLGAFTPDEIEGLAKELNVKREEVSEMETRLSGGDIALEGQVEDGEESYAPIAYLADSH
FT                   SEPTAVLASRQRDKLQSDGIASALDALDARSRRIIEARWLKVEDDGSGGSTLHELADEF
FT                   GVSAERIRQIEASAMKKMRGALTEYA"
     MTLPSTLSPS SAKAASAGAL ALSHSSLLPG QLGNIDAYIQ AVNRIPMLTP AEERQFATEF        60
     REQDNLESAR RLVLSHLRLV VSIARNYLGY GLPHADLIQE GNIGLMKAVK RFDPEQNVRL       120
     VSYAMHWIKA EIHEYILRNW RMVKVATTKA QRKLFFNLRS HKQGLGAFTP DEIEGLAKEL       180
     NVKREEVSEM ETRLSGGDIA LEGQVEDGEE SYAPIAYLAD SHSEPTAVLA SRQRDKLQSD       240
     GIASALDALD ARSRRIIEAR WLKVEDDGSG GSTLHELADE FGVSAERIRQ IEASAMKKMR       300
     GALTEYA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page