(data stored in ACNUC7421 zone)

EMBL: CP000270.PE317

CP000270.PE317       Location/Qualifiers
FT   CDS             353591..354154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4145"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28855"
FT                   /db_xref="GOA:Q145Y4"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y4"
FT                   /protein_id="ABE28855.1"
FT                   /translation="MNNKKNVLRDLALKITAGAVLVGASGVASADQFGVQVAGGLGDRH
FT                   VKKLDLGFVWDPDLNWWQIGDWHFSLIGEAHVAWWHTNEGNVHDNIGEVGVTPIIRFIK
FT                   ESGPIRPYAELGAGIRLLSSPRISSTFTLGTAFQFADMAGVGMQFGNRQQYQAGYRFQH
FT                   ISNGGIKEPNPGINFHQLYLQYNF"
     MNNKKNVLRD LALKITAGAV LVGASGVASA DQFGVQVAGG LGDRHVKKLD LGFVWDPDLN        60
     WWQIGDWHFS LIGEAHVAWW HTNEGNVHDN IGEVGVTPII RFIKESGPIR PYAELGAGIR       120
     LLSSPRISST FTLGTAFQFA DMAGVGMQFG NRQQYQAGYR FQHISNGGIK EPNPGINFHQ       180
     LYLQYNF                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page