(data stored in ACNUC7421 zone)

EMBL: CP000270.PE318

CP000270.PE318       Location/Qualifiers
FT   CDS             354198..354581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4144"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28856"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y3"
FT                   /protein_id="ABE28856.1"
FT                   /translation="MAAKIIEAIRGLERERFRAMVDGDGQSLDTLLAENVSYVHTNGKR
FT                   ETKRQFIDGIVAGRRRYRQIEVQSQDVLPVGRETCVVTGRALIEMEANNGALLFPIAYT
FT                   AIHTQADGQWRLIAWQATRCAIE"
     MAAKIIEAIR GLERERFRAM VDGDGQSLDT LLAENVSYVH TNGKRETKRQ FIDGIVAGRR        60
     RYRQIEVQSQ DVLPVGRETC VVTGRALIEM EANNGALLFP IAYTAIHTQA DGQWRLIAWQ       120
     ATRCAIE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page