(data stored in ACNUC7421 zone)

EMBL: CP000270.PE33

CP000270.PE33        Location/Qualifiers
FT   CDS             42394..44568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4429"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28571"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B8"
FT                   /protein_id="ABE28571.1"
FT                   /translation="MLKSLTRTVTMRGAALPGTPLGEPALLLRSIQGEEVLSQIYTYTL
FT                   NCCTPLASVMPEHAAANIDLKSMIGKELTVTIELEGMGDYVPGLAGIAGAANIGAGTRE
FT                   ISGIVTKAHYVGQSNQQSHYQLILAPWIWLADQRSDFRIFQGKTVVEIIEQVFENYMYS
FT                   YQMRLSEQYPVLDYQVQYGETDFYFVQRLMAEHGIYWFFEHSDGFHRMILVDQPGAHKP
FT                   VESAAYQTLWYFPPGHKIDREYVDRFTLGGSLQSGRWTTNDFDFKKPNAVLIEQNELPQ
FT                   KTAHSNLERYEWPGDYTNPSHGEQFARLRMEEVRAHGERARGSGNVRDIVCGTTFRLEG
FT                   YPHEAANQEYLVISSSIAASEADQTTGSSEYTFKSSFLVQPATTVFRPSRKPYPKPRTS
FT                   GPQTAIVTGPPDQEIWTDQYGRVKLSFHWDRSGVKDQSSSCWIRVSYPWVGTNYGSINI
FT                   PRIGTEVIVDFENGDPDLPIVTGRVYNAASMPPWPLPAGATQSGTLSRSTKGGGYDNAN
FT                   AIRFEDMKGSEELWLHAEKDQRIEVEHDESHWVGNNRLKTIDGNETVKVNMNRTEAVAL
FT                   NETIAVGMNRSEIVGLNETVVVGVNRMITTGIDQAVQVGVNSMMTVGAMQTESIGSNYQ
FT                   LTVGSNFTSQIGNSLSQSAGQSISMTAGKMVSVNSGGTAGYSASDKLTLQCGQASISLE
FT                   SNGNITISGTSIDVQGSQHVGINGAIVDIN"
     MLKSLTRTVT MRGAALPGTP LGEPALLLRS IQGEEVLSQI YTYTLNCCTP LASVMPEHAA        60
     ANIDLKSMIG KELTVTIELE GMGDYVPGLA GIAGAANIGA GTREISGIVT KAHYVGQSNQ       120
     QSHYQLILAP WIWLADQRSD FRIFQGKTVV EIIEQVFENY MYSYQMRLSE QYPVLDYQVQ       180
     YGETDFYFVQ RLMAEHGIYW FFEHSDGFHR MILVDQPGAH KPVESAAYQT LWYFPPGHKI       240
     DREYVDRFTL GGSLQSGRWT TNDFDFKKPN AVLIEQNELP QKTAHSNLER YEWPGDYTNP       300
     SHGEQFARLR MEEVRAHGER ARGSGNVRDI VCGTTFRLEG YPHEAANQEY LVISSSIAAS       360
     EADQTTGSSE YTFKSSFLVQ PATTVFRPSR KPYPKPRTSG PQTAIVTGPP DQEIWTDQYG       420
     RVKLSFHWDR SGVKDQSSSC WIRVSYPWVG TNYGSINIPR IGTEVIVDFE NGDPDLPIVT       480
     GRVYNAASMP PWPLPAGATQ SGTLSRSTKG GGYDNANAIR FEDMKGSEEL WLHAEKDQRI       540
     EVEHDESHWV GNNRLKTIDG NETVKVNMNR TEAVALNETI AVGMNRSEIV GLNETVVVGV       600
     NRMITTGIDQ AVQVGVNSMM TVGAMQTESI GSNYQLTVGS NFTSQIGNSL SQSAGQSISM       660
     TAGKMVSVNS GGTAGYSASD KLTLQCGQAS ISLESNGNIT ISGTSIDVQG SQHVGINGAI       720
     VDIN                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page