(data stored in ACNUC7421 zone)

EMBL: CP000270.PE330

CP000270.PE330       Location/Qualifiers
FT   CDS             complement(364346..365227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4132"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28868"
FT                   /db_xref="GOA:Q145X1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145X1"
FT                   /protein_id="ABE28868.1"
FT                   /translation="MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGD
FT                   TLHFTRRDDGLITRRTEIADVPPEHDLTVRAATLLKTHTGSPEGVDIEIDKRLPMGAGL
FT                   GGGSSNAATTLLALNRLWKLNLPRLELQALALKLGADVPFFVFGKNAFAQGVGEALDVV
FT                   QLPPRHFLVVTPRVHVPTAAIFSEKALTRDSKPLTITDFPAELSCNTEWPESFGRNDMQ
FT                   QVVVGKYAEVAQVLRWFENVAPARMSGSGASVFAAFRSKAEAEAVQAKLPAEWNSAVAA
FT                   SLDQHPLFTFAS"
     MIETTDSLRD CLAPAKLNLF LHITGRRPDG YHTLQTVFQL LDWGDTLHFT RRDDGLITRR        60
     TEIADVPPEH DLTVRAATLL KTHTGSPEGV DIEIDKRLPM GAGLGGGSSN AATTLLALNR       120
     LWKLNLPRLE LQALALKLGA DVPFFVFGKN AFAQGVGEAL DVVQLPPRHF LVVTPRVHVP       180
     TAAIFSEKAL TRDSKPLTIT DFPAELSCNT EWPESFGRND MQQVVVGKYA EVAQVLRWFE       240
     NVAPARMSGS GASVFAAFRS KAEAEAVQAK LPAEWNSAVA ASLDQHPLFT FAS              293
//

If you have problems or comments...

PBIL Back to PBIL home page