(data stored in ACNUC7421 zone)

EMBL: CP000270.PE336

CP000270.PE336       Location/Qualifiers
FT   CDS             complement(370550..371488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4126"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28874"
FT                   /db_xref="GOA:Q145W5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145W5"
FT                   /protein_id="ABE28874.1"
FT                   /translation="MGTRCYDEIYGFDDSMRIILITGISGSGKSVALNALEDAGYYCVD
FT                   NLPPRFLPQLASYLAEDGQDRLAVAIDARSSASLDEMPAMIRDLSRAHDVRVLFLNAST
FT                   QSLIQRFSETRRRHPLSGSTSHDADVGLLNSLAEAIERERELVAGLAEFGHQIDTSNLR
FT                   ANVLRAWVKRFIEQKDSGLVLMFESFGFKRGVPLDADFVFDVRTLPNPYYDHELRPLTG
FT                   LDKPVIDFLDALPVVHEMIDDIEKFLAKWLPHFRDDNRSYLTVAIGCTGGQHRSVFIAE
FT                   TLAARLAASANVIVRHRDAPVEAGESSKLVA"
     MGTRCYDEIY GFDDSMRIIL ITGISGSGKS VALNALEDAG YYCVDNLPPR FLPQLASYLA        60
     EDGQDRLAVA IDARSSASLD EMPAMIRDLS RAHDVRVLFL NASTQSLIQR FSETRRRHPL       120
     SGSTSHDADV GLLNSLAEAI ERERELVAGL AEFGHQIDTS NLRANVLRAW VKRFIEQKDS       180
     GLVLMFESFG FKRGVPLDAD FVFDVRTLPN PYYDHELRPL TGLDKPVIDF LDALPVVHEM       240
     IDDIEKFLAK WLPHFRDDNR SYLTVAIGCT GGQHRSVFIA ETLAARLAAS ANVIVRHRDA       300
     PVEAGESSKL VA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page