(data stored in ACNUC7421 zone)

EMBL: CP000270.PE34

CP000270.PE34        Location/Qualifiers
FT   CDS             44699..46036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4428"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28572"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B7"
FT                   /protein_id="ABE28572.1"
FT                   /translation="MQFLNLTPFDTLCFGGVDLEDEQFRVVVMKVGYELLPTDVPGRFV
FT                   AQTVKEPVPLCMRDEYYGAVNESSVREESDLAHYKPRCDVIIRGSTHAPDGVAATHWNA
FT                   RIKVSSPQSSLQTVSQVAGLSAKLDLKPALDARYAERWAIPVALPEHSFDPGTSRQVLL
FT                   DKTLQVSGPREFQRHFAGWSVSTPQAATHVPLRWEHAFGGGSVVRNPRHGQDPDEVEFL
FT                   LNEVCFSNPLGCGWIEDRYADTLRKAGLKQPERLPAPQIEVPDGPTRRPVTILHPDQFD
FT                   TTNPAEFIRIAQGYGELPAGFGIVGRSWAPRLQLAGTYDEKWKDERWPLLPDDFDFGYW
FT                   NCAPRDQQIEALPADARLELWNLVDSALTPDGYLRVELPGDWPLVYIHRNDGICLPMPM
FT                   TTDTLLIDTDAMTLTLTHRFPFIEESFIERVEAHIHRPLGTPLATV"
     MQFLNLTPFD TLCFGGVDLE DEQFRVVVMK VGYELLPTDV PGRFVAQTVK EPVPLCMRDE        60
     YYGAVNESSV REESDLAHYK PRCDVIIRGS THAPDGVAAT HWNARIKVSS PQSSLQTVSQ       120
     VAGLSAKLDL KPALDARYAE RWAIPVALPE HSFDPGTSRQ VLLDKTLQVS GPREFQRHFA       180
     GWSVSTPQAA THVPLRWEHA FGGGSVVRNP RHGQDPDEVE FLLNEVCFSN PLGCGWIEDR       240
     YADTLRKAGL KQPERLPAPQ IEVPDGPTRR PVTILHPDQF DTTNPAEFIR IAQGYGELPA       300
     GFGIVGRSWA PRLQLAGTYD EKWKDERWPL LPDDFDFGYW NCAPRDQQIE ALPADARLEL       360
     WNLVDSALTP DGYLRVELPG DWPLVYIHRN DGICLPMPMT TDTLLIDTDA MTLTLTHRFP       420
     FIEESFIERV EAHIHRPLGT PLATV                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page