(data stored in ACNUC7421 zone)

EMBL: CP000270.PE348

CP000270.PE348       Location/Qualifiers
FT   CDS             382283..382897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4114"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28886"
FT                   /db_xref="GOA:Q145V3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V3"
FT                   /protein_id="ABE28886.1"
FT                   /translation="MPDFLLFLATSIAITVAPGPDNLQVLARGISQGRAAGFVAALGFA
FT                   AGITFHTTLAALGVAALLRSSPTAFTAIKLAGAAYLIWIGIKALRSQGLATAHERAPQP
FT                   LMAVFRQSVLGNLLNPKVTLFFVVFLPQFVQPNGTQSVTLQMLELGVLFMLQTVVVFSL
FT                   FGVCAGMVGGYLKRRPRVGVWLDRLAGATFIAIGIRVALRD"
     MPDFLLFLAT SIAITVAPGP DNLQVLARGI SQGRAAGFVA ALGFAAGITF HTTLAALGVA        60
     ALLRSSPTAF TAIKLAGAAY LIWIGIKALR SQGLATAHER APQPLMAVFR QSVLGNLLNP       120
     KVTLFFVVFL PQFVQPNGTQ SVTLQMLELG VLFMLQTVVV FSLFGVCAGM VGGYLKRRPR       180
     VGVWLDRLAG ATFIAIGIRV ALRD                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page