(data stored in ACNUC7421 zone)

EMBL: CP000270.PE35

CP000270.PE35        Location/Qualifiers
FT   CDS             46092..46448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4427"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28573"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B6"
FT                   /protein_id="ABE28573.1"
FT                   /translation="MATNLIARRDGGWVVISKVPDVCLTFIGAIPVPVPYPVFASLQPA
FT                   QQTTTNVNVNGDPIVVFDSSFVPMTQGGEAGTQGGIMSGTTAQKTRPLQHSNTVKCQGK
FT                   FIVRAEDLFSMNGP"
     MATNLIARRD GGWVVISKVP DVCLTFIGAI PVPVPYPVFA SLQPAQQTTT NVNVNGDPIV        60
     VFDSSFVPMT QGGEAGTQGG IMSGTTAQKT RPLQHSNTVK CQGKFIVRAE DLFSMNGP         118
//

If you have problems or comments...

PBIL Back to PBIL home page