(data stored in ACNUC7421 zone)

EMBL: CP000270.PE351

CP000270.PE351       Location/Qualifiers
FT   CDS             complement(384870..386096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4111"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28889"
FT                   /db_xref="GOA:Q145V0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V0"
FT                   /protein_id="ABE28889.1"
FT                   /translation="MRRQLVRLHRWFGVATALFLFVAGLTGAVIAWDHELDAALNPSFF
FT                   KARTAGTALSGLELARRVEAADPRLQVTYLPLAAEPGHTLQMMVLPRTDPATRQPYPLD
FT                   FNQIAVDPATGEIQGRREWGAVSLARLNLIPFIYKLHYTLQLPFTGGVDIGTWLMGIVG
FT                   IVWLFDSVIALWLSFPSVKVWRKSFAFRFGRGGYALTFDLHRSGGVWIWGLLLIVALTS
FT                   ISMNLSAPVVRPIVSLFSPLTPDPVNNPEIRRAPQPGDTVLSRERIVQLAEQAGKARNL
FT                   GVAPGGIYYAEFMHAYGVGFYATGNDHGDIGLGNPWMYWDAATGRQLAAQIPGKGTAGD
FT                   IFLQVQFPLHSGRILGLGGRILISAVGVAVAVLSATGLLIWLKKLNARRRSAQNASAAR
FT                   DAGRSAARP"
     MRRQLVRLHR WFGVATALFL FVAGLTGAVI AWDHELDAAL NPSFFKARTA GTALSGLELA        60
     RRVEAADPRL QVTYLPLAAE PGHTLQMMVL PRTDPATRQP YPLDFNQIAV DPATGEIQGR       120
     REWGAVSLAR LNLIPFIYKL HYTLQLPFTG GVDIGTWLMG IVGIVWLFDS VIALWLSFPS       180
     VKVWRKSFAF RFGRGGYALT FDLHRSGGVW IWGLLLIVAL TSISMNLSAP VVRPIVSLFS       240
     PLTPDPVNNP EIRRAPQPGD TVLSRERIVQ LAEQAGKARN LGVAPGGIYY AEFMHAYGVG       300
     FYATGNDHGD IGLGNPWMYW DAATGRQLAA QIPGKGTAGD IFLQVQFPLH SGRILGLGGR       360
     ILISAVGVAV AVLSATGLLI WLKKLNARRR SAQNASAARD AGRSAARP                    408
//

If you have problems or comments...

PBIL Back to PBIL home page