(data stored in ACNUC7421 zone)

EMBL: CP000270.PE353

CP000270.PE353       Location/Qualifiers
FT   CDS             complement(387807..390680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4108"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4108"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28891"
FT                   /db_xref="GOA:Q145U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U8"
FT                   /protein_id="ABE28891.1"
FT                   /translation="MEQIRIRGARTHNLKNVNLDLPRHKLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLFARVGTPYCPDHEIPLEAQSVSQMVDAALALPDETKLMILAPVVANRKGEHV
FT                   ELFEEMQAQGFIRFRVRSGGGTANEGVAKIYEVDSLPKLKKNDKHTIDVVVDRLKVRPD
FT                   MKQRLAESFETALRLADGRAIALEMDTDKEHLFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPECDGLGQITFFDPKRVVAHPSLSLAAGAVKGWDRRNQFYFQMLQSLAAFYEFDI
FT                   DTAVEDLPEKVRKILLFGSGKQEIPFSYINERGRTSVREHVFEGIIPNLERRYRETDSV
FT                   AVREELAKYQNNQPCPACAGTRLRREARFVRIGTDSDARGIFEISGWPLRDALGYFQTL
FT                   RLEGSKREIADKVVKEIVARLMFLNNVGLDYLSLERSAETLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIATLKHLRDLGNSVIVVEHDEDMIRMADYVVDMGPGA
FT                   GEHGGMVIAEGTPKQVQANAASMTGQYMSGARNIEFPDERKAPDERRLRIVEAYGNNLK
FT                   HVSLDLPVGLLTCVTGVSGSGKSTLINDTLYHAVAHHLYGSATEPAPYESIEGLEHFDK
FT                   VINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPAAKERGYEAGRFSFNVKGGRCESC
FT                   QGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLDVQYKGRNISEVLDMTVENAYEFFKP
FT                   VPVVARKLKTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPTT
FT                   GLHFHDIALLLEVIHRLRDQGNTVVIIEHNLDVIKTADWVIDLGPEGGAGGGQIVAQGT
FT                   PEQVAKSKASFTGKYLAPLLKRAASKK"
     MEQIRIRGAR THNLKNVNLD LPRHKLVVIT GLSGSGKSSL AFDTLYAEGQ RRYVESLSAY        60
     ARQFLQLMEK PDVDLIEGLS PAISIEQKAT SHNPRSTVGT VTEIHDYLRL LFARVGTPYC       120
     PDHEIPLEAQ SVSQMVDAAL ALPDETKLMI LAPVVANRKG EHVELFEEMQ AQGFIRFRVR       180
     SGGGTANEGV AKIYEVDSLP KLKKNDKHTI DVVVDRLKVR PDMKQRLAES FETALRLADG       240
     RAIALEMDTD KEHLFSSKFA CPICSYSLQE LEPRLFSFNN PMGACPECDG LGQITFFDPK       300
     RVVAHPSLSL AAGAVKGWDR RNQFYFQMLQ SLAAFYEFDI DTAVEDLPEK VRKILLFGSG       360
     KQEIPFSYIN ERGRTSVREH VFEGIIPNLE RRYRETDSVA VREELAKYQN NQPCPACAGT       420
     RLRREARFVR IGTDSDARGI FEISGWPLRD ALGYFQTLRL EGSKREIADK VVKEIVARLM       480
     FLNNVGLDYL SLERSAETLS GGEAQRIRLA SQIGSGLTGV MYVLDEPSIG LHQRDNDRLI       540
     ATLKHLRDLG NSVIVVEHDE DMIRMADYVV DMGPGAGEHG GMVIAEGTPK QVQANAASMT       600
     GQYMSGARNI EFPDERKAPD ERRLRIVEAY GNNLKHVSLD LPVGLLTCVT GVSGSGKSTL       660
     INDTLYHAVA HHLYGSATEP APYESIEGLE HFDKVINVDQ SPIGRTPRSN PATYTGLFTP       720
     IRELFAGVPA AKERGYEAGR FSFNVKGGRC ESCQGDGVLK VEMHFLPDVY VPCDVCHGKR       780
     YNRETLDVQY KGRNISEVLD MTVENAYEFF KPVPVVARKL KTLLDVGLGY IRLGQSATTL       840
     SGGEAQRVKL SLELSKRDTG RTLYILDEPT TGLHFHDIAL LLEVIHRLRD QGNTVVIIEH       900
     NLDVIKTADW VIDLGPEGGA GGGQIVAQGT PEQVAKSKAS FTGKYLAPLL KRAASKK          957
//

If you have problems or comments...

PBIL Back to PBIL home page