(data stored in ACNUC7421 zone)

EMBL: CP000270.PE357

CP000270.PE357       Location/Qualifiers
FT   CDS             complement(394477..394908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4104"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28895"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U4"
FT                   /protein_id="ABE28895.1"
FT                   /translation="MPNFIKHIAFKVEDVEKERAFYENVFGYKHVNTVRRKGKNGDHIS
FT                   HHLTDGYMDLTLIHYESSDSDEADFAGPAPCIHHIGMEVEDLDAFIEQIKENGGEILTA
FT                   PGHLPVKFRSPNGPVAEVVPMQRWEKKTLAAGVHGEVLE"
     MPNFIKHIAF KVEDVEKERA FYENVFGYKH VNTVRRKGKN GDHISHHLTD GYMDLTLIHY        60
     ESSDSDEADF AGPAPCIHHI GMEVEDLDAF IEQIKENGGE ILTAPGHLPV KFRSPNGPVA       120
     EVVPMQRWEK KTLAAGVHGE VLE                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page