(data stored in ACNUC7421 zone)

EMBL: CP000270.PE36

CP000270.PE36        Location/Qualifiers
FT   CDS             46582..50670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4426"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28574"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B5"
FT                   /protein_id="ABE28574.1"
FT                   /translation="MPRGKLTPTQVQNFLNGGSGNTFGNPTQKQLPQSQRSISNPGGKG
FT                   GVNLKPTDPDWKEHFHEIMDMFGNIPVIGSLFNAINAGVYLAEGNVASAMENLGYVVMD
FT                   LIPGAGELKSAGNIGEDIGKLAEKTGTRLTEGEAEKAGKQIAEKQAEKQAEKRAEKRAE
FT                   KQAGEQAEKDGGKAEKEKQEACRNNKGVGHPVNPITGVKFLDGEEDLDFVLPCAVPLHW
FT                   QRSYFSNLVGNGWLGQGWSLPFSLCLKRVGYSVLMVDAQGHETRLPMLAPGERKRMDST
FT                   GFEVHRETSARYRFTSADCSTQYVFASLTVGEYDGAGQNDGTLPLVAIGDRYGNHQRLL
FT                   YDEAGMPALIHDAGGRVLRLQFTALPVDEGGTVQRLQRVVLGSQALVSYEYSPEGDLVR
FT                   VRDADGQATREYRYNNHILIEHSQPGALIARYEYDQYTLDGKVLRLENNLGQTWQFRYL
FT                   PSRTEVTDALGQTRCYLFNDQKMMVGQIDAAGNATRIDVDGQGNPLRVTDPAGGVRLAT
FT                   YDARGNMTSLTDAAGRRTEIQYHPQWQRPTLIVDAMGAATRVAYDAAGNLIRRTNALGH
FT                   VTGYAYDDDGRVIRITDAHGKHRHFAYDVHGRLTSHIDCSGRATHYGWDDWGHLALVTN
FT                   AAGETTRYWRNRRGRLLRTRHADGTGEEFTYDIHGRLIAHTDAHGASTQWERAADGLPV
FT                   TRIDALGHCLRYEYDAARRLQTLTNENGAPYRFTYDTAGRLVEQQGFDGRLIRYRYDAA
FT                   GWLTEQIELGAYEDHAAADGNHPDTLRTTYERDKAGRITATTISRAGDERTERITWRYD
FT                   AAGRLIEASNDCCRLERGYDAVGRLSSETSHVAGRSLTVSYEHDALGNHIRTTLPDGRH
FT                   IDYLYYGSGHLHQISIDGEVISDIERDALHREVSRTQGELVSHYQYDLQGRHIGQQTMG
FT                   RAVSGHSAITLISRTYRYDEVGNVREMTDRQSGVHRYRYDPLGQLIESEHETFALDPAH
FT                   NILDSRDLSPVVGNRVMQFGQHRYVYDMHGNVVEKISGAHTRIRLDYSPAHRIERARVA
FT                   RNGTEERVEYGYDALGRRVFRKNASGITLFVWEGNRLLSEVRDDRTFVYVYAHNSFVPV
FT                   AQIESRNAQNGRARDDLPIRYYHTDQIGLPYESTDDAGRTQWRARYAAWGRLLGANGGH
FT                   EQMHESGRQAHQPLRFQGQYFDEETGLHYNRHRYYDPDAGRFMTQDPIGLRGGINLYRY
FT                   APNPGRWIDPLGLAVDLSLVGPHYACNLNNFPNTFQVLGHGSPGGNIADLSGETLTPSE
FT                   LGDYMREASNYRQGQPVTLYACHLGAGGKNSYAQQLSNYLGADVNAPTDVLKTIDLGDG
FT                   DVMALVANGGGWQKFSPIC"
     MPRGKLTPTQ VQNFLNGGSG NTFGNPTQKQ LPQSQRSISN PGGKGGVNLK PTDPDWKEHF        60
     HEIMDMFGNI PVIGSLFNAI NAGVYLAEGN VASAMENLGY VVMDLIPGAG ELKSAGNIGE       120
     DIGKLAEKTG TRLTEGEAEK AGKQIAEKQA EKQAEKRAEK RAEKQAGEQA EKDGGKAEKE       180
     KQEACRNNKG VGHPVNPITG VKFLDGEEDL DFVLPCAVPL HWQRSYFSNL VGNGWLGQGW       240
     SLPFSLCLKR VGYSVLMVDA QGHETRLPML APGERKRMDS TGFEVHRETS ARYRFTSADC       300
     STQYVFASLT VGEYDGAGQN DGTLPLVAIG DRYGNHQRLL YDEAGMPALI HDAGGRVLRL       360
     QFTALPVDEG GTVQRLQRVV LGSQALVSYE YSPEGDLVRV RDADGQATRE YRYNNHILIE       420
     HSQPGALIAR YEYDQYTLDG KVLRLENNLG QTWQFRYLPS RTEVTDALGQ TRCYLFNDQK       480
     MMVGQIDAAG NATRIDVDGQ GNPLRVTDPA GGVRLATYDA RGNMTSLTDA AGRRTEIQYH       540
     PQWQRPTLIV DAMGAATRVA YDAAGNLIRR TNALGHVTGY AYDDDGRVIR ITDAHGKHRH       600
     FAYDVHGRLT SHIDCSGRAT HYGWDDWGHL ALVTNAAGET TRYWRNRRGR LLRTRHADGT       660
     GEEFTYDIHG RLIAHTDAHG ASTQWERAAD GLPVTRIDAL GHCLRYEYDA ARRLQTLTNE       720
     NGAPYRFTYD TAGRLVEQQG FDGRLIRYRY DAAGWLTEQI ELGAYEDHAA ADGNHPDTLR       780
     TTYERDKAGR ITATTISRAG DERTERITWR YDAAGRLIEA SNDCCRLERG YDAVGRLSSE       840
     TSHVAGRSLT VSYEHDALGN HIRTTLPDGR HIDYLYYGSG HLHQISIDGE VISDIERDAL       900
     HREVSRTQGE LVSHYQYDLQ GRHIGQQTMG RAVSGHSAIT LISRTYRYDE VGNVREMTDR       960
     QSGVHRYRYD PLGQLIESEH ETFALDPAHN ILDSRDLSPV VGNRVMQFGQ HRYVYDMHGN      1020
     VVEKISGAHT RIRLDYSPAH RIERARVARN GTEERVEYGY DALGRRVFRK NASGITLFVW      1080
     EGNRLLSEVR DDRTFVYVYA HNSFVPVAQI ESRNAQNGRA RDDLPIRYYH TDQIGLPYES      1140
     TDDAGRTQWR ARYAAWGRLL GANGGHEQMH ESGRQAHQPL RFQGQYFDEE TGLHYNRHRY      1200
     YDPDAGRFMT QDPIGLRGGI NLYRYAPNPG RWIDPLGLAV DLSLVGPHYA CNLNNFPNTF      1260
     QVLGHGSPGG NIADLSGETL TPSELGDYMR EASNYRQGQP VTLYACHLGA GGKNSYAQQL      1320
     SNYLGADVNA PTDVLKTIDL GDGDVMALVA NGGGWQKFSP IC                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page