(data stored in ACNUC7421 zone)

EMBL: CP000270.PE368

CP000270.PE368       Location/Qualifiers
FT   CDS             complement(407468..408019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4093"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28906"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T3"
FT                   /protein_id="ABE28906.1"
FT                   /translation="MTNKRMIKASLLALFSLGAALGVALGDANAQTPASQPSAGGLPAR
FT                   SPFDIPYGMPISLQNANQALQAAEAEAARHGWPEAIAVTDPSGELVAFAKMDDTQNSSP
FT                   NIALRKAATAARFRRDTRTFYNGFEAGHTYSATLDPSVVASPGGYPLVIGGKIVGAIGC
FT                   SGGSGDQDADICKAGADALK"
     MTNKRMIKAS LLALFSLGAA LGVALGDANA QTPASQPSAG GLPARSPFDI PYGMPISLQN        60
     ANQALQAAEA EAARHGWPEA IAVTDPSGEL VAFAKMDDTQ NSSPNIALRK AATAARFRRD       120
     TRTFYNGFEA GHTYSATLDP SVVASPGGYP LVIGGKIVGA IGCSGGSGDQ DADICKAGAD       180
     ALK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page