(data stored in ACNUC7421 zone)

EMBL: CP000270.PE369

CP000270.PE369       Location/Qualifiers
FT   CDS             complement(408125..408862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4092"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28907"
FT                   /db_xref="GOA:Q145T2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T2"
FT                   /protein_id="ABE28907.1"
FT                   /translation="MHNAAQHSVVSDALAGFAVAALPASAESALGAARDALTHARLLTD
FT                   PATRSTAQITALLQSQGSATTDSRTRAWILGTSLATQAAASPAMPVLAAVIATGDKLGS
FT                   SESDAIAAVAIGTEAATRILAAVDSDEFRARWNVASSVGLLGAVLAVSRLLRLDEAHTR
FT                   HALGIAATQAAGLAHNADHAMEAIEIGKAAADALEAAMIAKHGFTSAAASIDGRRGFAA
FT                   LMAYRFDASAITDALGTRWTSLD"
     MHNAAQHSVV SDALAGFAVA ALPASAESAL GAARDALTHA RLLTDPATRS TAQITALLQS        60
     QGSATTDSRT RAWILGTSLA TQAAASPAMP VLAAVIATGD KLGSSESDAI AAVAIGTEAA       120
     TRILAAVDSD EFRARWNVAS SVGLLGAVLA VSRLLRLDEA HTRHALGIAA TQAAGLAHNA       180
     DHAMEAIEIG KAAADALEAA MIAKHGFTSA AASIDGRRGF AALMAYRFDA SAITDALGTR       240
     WTSLD                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page