(data stored in ACNUC7421 zone)

EMBL: CP000270.PE38

CP000270.PE38        Location/Qualifiers
FT   CDS             51583..52461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4424"
FT                   /product="Putative patatin-like phospholipase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28576"
FT                   /db_xref="GOA:Q147B3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B3"
FT                   /protein_id="ABE28576.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVQPELRIRPRVITGISAGAATA
FT                   CMLYTRDSDWVMRYYEDALRHNTRNAYWGNLLRGESVFPHYRIYRQALLDIYGEKFSTL
FT                   ADAPEIRIGVSHLPRWLGARSAVAAGLIAYNIEKYVRKTLHPTLGQTLGFHPEFVRAQD
FT                   CASVEDLADLILQSSSTPPFTPVLRRNGRPVLDGGMVDNVPVGALDAEAPGYVLVMVTR
FT                   LYPRPQMFVVPHGVQQRLYVQPSRKVPISSWDYTSPSQMVHAYNLGRADGETFLERVPD
FT                   LLEAGAHEAAR"
     MFDQVVFAGG GNRCWWQAGF WDVVQPELRI RPRVITGISA GAATACMLYT RDSDWVMRYY        60
     EDALRHNTRN AYWGNLLRGE SVFPHYRIYR QALLDIYGEK FSTLADAPEI RIGVSHLPRW       120
     LGARSAVAAG LIAYNIEKYV RKTLHPTLGQ TLGFHPEFVR AQDCASVEDL ADLILQSSST       180
     PPFTPVLRRN GRPVLDGGMV DNVPVGALDA EAPGYVLVMV TRLYPRPQMF VVPHGVQQRL       240
     YVQPSRKVPI SSWDYTSPSQ MVHAYNLGRA DGETFLERVP DLLEAGAHEA AR               292
//

If you have problems or comments...

PBIL Back to PBIL home page