(data stored in ACNUC7421 zone)

EMBL: CP000270.PE384

CP000270.PE384       Location/Qualifiers
FT   CDS             complement(425571..426143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4077"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28922"
FT                   /db_xref="GOA:Q145R7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R7"
FT                   /protein_id="ABE28922.1"
FT                   /translation="MSTDSNHQSGGGHAVALRAERRWAIFAVALIVLMLAVIVYSGLHW
FT                   AMMPPSRVETIDPSRLQLSGEFVEDNLGSAVEPDGSVVVRFIAQQYSFTPQCLLVPADT
FT                   PITIRTTSADVVHGLLVTDTNINTMVVPGYVATLNTRFDTPADHTMPCHEFCGFGHQTM
FT                   WAHVKVIDKATFFEQARQSRRLSCVSR"
     MSTDSNHQSG GGHAVALRAE RRWAIFAVAL IVLMLAVIVY SGLHWAMMPP SRVETIDPSR        60
     LQLSGEFVED NLGSAVEPDG SVVVRFIAQQ YSFTPQCLLV PADTPITIRT TSADVVHGLL       120
     VTDTNINTMV VPGYVATLNT RFDTPADHTM PCHEFCGFGH QTMWAHVKVI DKATFFEQAR       180
     QSRRLSCVSR                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page