(data stored in ACNUC7421 zone)

EMBL: CP000270.PE387

CP000270.PE387       Location/Qualifiers
FT   CDS             complement(427750..428523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4074"
FT                   /product="Putative periplasmic cytochrome c protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28925"
FT                   /db_xref="GOA:Q145R4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R4"
FT                   /protein_id="ABE28925.1"
FT                   /translation="MSERARNNREEERSQQRSGVHRRTVRSYVLLVFYVLWSGVALAAT
FT                   DASSTMPSAMDERVRACTSCHGVQGQGLNNDYFPRIAGKPAEYLFNQLTAFRDGGRTYP
FT                   PMGYLLAFLPDDYLRKISQYFADLQPPYPNADQSNVAPAVLAAGQRLVTQGDPSRKIPA
FT                   CIACHGARMTGTQPGIPGLLGLHASYIAGQMGTWRSGTRHALAPDCMHSIAVKLSDKDI
FT                   TAVSSWLARQPRPADPRPAPASGERLPLACGSQPQ"
     MSERARNNRE EERSQQRSGV HRRTVRSYVL LVFYVLWSGV ALAATDASST MPSAMDERVR        60
     ACTSCHGVQG QGLNNDYFPR IAGKPAEYLF NQLTAFRDGG RTYPPMGYLL AFLPDDYLRK       120
     ISQYFADLQP PYPNADQSNV APAVLAAGQR LVTQGDPSRK IPACIACHGA RMTGTQPGIP       180
     GLLGLHASYI AGQMGTWRSG TRHALAPDCM HSIAVKLSDK DITAVSSWLA RQPRPADPRP       240
     APASGERLPL ACGSQPQ                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page